old.robetta.org

A new Robetta server is available for structure prediction.

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     

Fragment Server Job 82055


DOWNLOADS

Target: pep_cort_n
Status: Complete
Date Submitted: 10/23/24 10:58:56 AM
Started: 10/23/24 10:58:57 AM
Ended: 10/23/24 11:07:20 AM
Expires: 10/30/24 11:07:20 AM   (6 days 18:32:12)
Sequence:
EAVQNHIGSLNLGWRVALREPGGTCASWRGKSLR
Length: 34
Exclude Homologues: no





Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington