old.robetta.org

A new Robetta server is available for structure prediction.

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     

Fragment Server Job 82153


DOWNLOADS

Target: small_test
Status: Complete
Date Submitted: 01/20/25 04:16:04 AM
Started: 01/20/25 04:16:09 AM
Ended: 01/20/25 04:24:31 AM
Expires: 01/27/25 04:24:31 AM   (3 days 03:42:56)
Sequence:
MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDM
Length: 41
Exclude Homologues: no





Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington