old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250
	GQSYEELIEKSYDFVDKGDLVSAEESLKAAMRKEPANPLNYALLTNLGTIQRRQGKLQEALISYTSALSGHTKNITILENRASLYTELGETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDESERIFNYLISEMPRDWILYEGRADLYFMMGKNARAMADIEKVFTESEPTANLYVLRGKIKLAQYEKERAALDFKKAESMGYNKEVIKELLKLTMNN
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	---HHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHHH--HHHHHHHHHHHHH-----HHHHHHHHHHHHHH--HHHHHHHHHHHHH-----HHHHHHHHHHH--

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    24	    0.110
  max. Y    41	    0.106
  max. S    30	    0.113
  mean S     1-40   0.096
       D     1-40   0.101    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.101 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
141	6.00	135,147

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-257	alignment	1w3bA_302	1-388	0.5422	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
999421	Parabacteroides merdae CL09T00C40	1 (0.06%)	9E-48	1-257	19-275	196	100	257	ref|WP_005634890.1|	hypothetical protein [Parabacteroides] gb|EDN84946.1| tetrat...
997885	Bacteroides ovatus CL02T12C04	1 (0.06%)	2E-46	1-253	18-270	192	38	253	ref|WP_004301105.1|	hypothetical protein [Bacteroides] gb|EDO10214.1| tetratrico...
997873	Bacteroides caccae CL03T12C61	1 (0.06%)	5E-45	1-253	18-270	187	38	253	ref|WP_005679664.1|	hypothetical protein [Bacteroides] gb|EDM19065.1| tetratrico...
449673	Bacteroides stercoris ATCC 43183	1 (0.06%)	6E-47	1-254	20-281	193	37	262	ref|WP_005654379.1|	hypothetical protein [Bacteroides stercoris] gb|EDS15019.1| ...
471870	Bacteroides intestinalis DSM 17393	1 (0.06%)	6E-47	2-253	21-272	194	36	252	ref|WP_007664505.1|	hypothetical protein [Bacteroides intestinalis] gb|EDV04100....
423472	Crocosphaera watsonii WH 0005	3 (0.17%)	5E-69	7-257	705-952	267	26	251	ref|WP_021832627.1|	TPR domain protein [Crocosphaera watsonii] emb|CCQ55026.1| T...
1133568	Brachyspira pilosicoli B2904	1 (0.06%)	2E-48	36-252	93-309	199	26	217	ref|YP_006706986.1|	hypothetical protein B2904_orf895 [Brachyspira pilosicoli B2...
203124	Trichodesmium erythraeum IMS101	59 (3.28%)	2E-75	2-257	288-541	288	25	257	ref|YP_722042.1|	hypothetical protein Tery_2349 [Trichodesmium erythraeum IMS...
213618	Microcystis aeruginosa PCC 7941	3 (0.17%)	1E-71	3-255	668-916	275	25	253	ref|WP_002774751.1|	Tetratricopeptide repeat protein (fragment) [Microcystis aer...
575540	Isosphaera pallida ATCC 43644	1 (0.06%)	8E-65	6-252	553-796	253	25	247	ref|YP_004177407.1|	serine/threonine protein kinase [Isosphaera pallida ATCC 436...
497965	Cyanothece sp. PCC 7822	6 (0.33%)	6E-61	7-253	404-652	240	25	253	ref|YP_003899606.1|	Tetratricopeptide repeat-containing protein [Cyanothece sp. ...
536019	Mesorhizobium opportunistum WSM2075	1 (0.06%)	5E-52	24-254	52-279	210	25	231	ref|YP_004610427.1|	TPR repeat-containing protein [Mesorhizobium opportunistum W...
32057	Calothrix sp. PCC 7103	3 (0.17%)	3E-76	4-257	760-1010	291	24	254	ref|WP_019496258.1|	hypothetical protein [Calothrix sp. PCC 7103]
77133	uncultured bacterium	1 (0.06%)	1E-63	2-252	322-569	249	24	251	gb|EKD52197.1|	peptidase C14 caspase catalytic subunit P20 [uncultured bact...
321332	Synechococcus sp. JA-2-3B'a(2-13)	1 (0.06%)	3E-60	7-240	298-527	238	24	234	ref|YP_477744.1|	TPR repeat-containing protein kinase [Synechococcus sp. JA-2...
1287056	Brachyspira hampsonii 30599	3 (0.17%)	1E-56	4-252	98-343	226	24	249	ref|WP_008730926.1|	hypothetical protein [Brachyspira hampsonii] gb|ELV05024.1| ...
314231	Fulvimarina pelagi HTCC2506	1 (0.06%)	2E-51	11-254	51-291	209	24	244	ref|WP_007067899.1|	GlcNAc transferase [Fulvimarina pelagi] gb|EAU41524.1| O-lin...
395492	Rhizobium leguminosarum bv. trifolii WSM2304	1 (0.06%)	3E-50	21-254	53-283	204	24	234	ref|YP_002282856.1|	hypothetical protein Rleg2_3363 [Rhizobium leguminosarum bv....
366394	Sinorhizobium medicae WSM419	2 (0.11%)	2E-49	24-254	64-291	202	24	231	ref|YP_001328419.1|	hypothetical protein Smed_2754 [Sinorhizobium medicae WSM419...
395491	Rhizobium leguminosarum bv. trifolii WSM1325	1 (0.06%)	1E-49	21-254	53-283	202	24	234	ref|YP_002977447.1|	hypothetical protein Rleg_3665 [Rhizobium leguminosarum bv. ...