old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 .
	MSQSVTVIGLGPMGQAMAAAYLDRGYEVTLWNRTASRADALVARGAKLAATPEQALSANELVILSLIDYDAMYGVLEGAEEAVAGRVLVNLSSDTPEKARAAARRVAELGGTHLTGGVLSPPPGIGSPDMSTFYSGPRAAYDQHRAALEVITGKTDYRGEDPGLAALMYQLNMVVFWPAMLSYWQAVALADAHGLTAADIAPYVSENFAGMGQFIDFYAARIDAGNHAGDVDRLSMGVASMEHVVHTNADSGVDTAFPRAVLDAFHRGADAGFGADSFSSVIKLMKKQP
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (3%)	--------------------------------------------------------------------------------------------------XXXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	X-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	---EEEEEEEHHHHHHHHHHHHH---EEEEE---HHHHHHHHH---EEE--HHHHH----EEEEE---HHHHHHHHHH--------EEEE-----HHHHHHHHHHHHH--------EEE-----------EEEE---HHHHHHHHHHHHHH---EEEE-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHH-----HHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH-------HHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    19	    0.570
  max. Y    19	    0.411
  max. S    16	    0.521
  mean S     1-18   0.300
       D     1-18   0.359    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.359 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-289	alignment	3dojA_101	1-292	0.6736	OXIDOREDUCTASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
457429	Streptomyces pristinaespiralis ATCC 25486	5 (0.12%)	2E-53	3-287	6-290	216	70	285	ref|WP_005307639.1|	6-phosphogluconate dehydrogenase [Streptomyces pristinaespir...
455632	Streptomyces griseus subsp. griseus NBRC 13350	6 (0.15%)	4E-54	5-287	8-290	218	63	283	ref|YP_001823476.1|	dehydrogenase [Streptomyces griseus subsp. griseus NBRC 1335...
278992	Streptomyces ambofaciens ATCC 23877	5 (0.12%)	9E-57	1-287	1-287	226	59	288	emb|CAJ89283.1|	putative beta-hydroxyacid dehydrogenase [Streptomyces ambofa...
285525	Streptomyces sahachiroi	1 (0.03%)	1E-49	7-286	1-283	203	42	284	gb|ABY83183.1|	Azi45 [Streptomyces sahachiroi]
572264	Bacillus cereus 03BB102	1 (0.03%)	2E-56	4-287	31-314	225	38	284	ref|YP_002749124.1|	putative dehydrogenase [Bacillus cereus 03BB102] ref|WP_0007...
412694	Bacillus thuringiensis str. Al Hakam	2 (0.05%)	1E-54	4-287	9-292	219	38	284	ref|YP_894455.1|	dehydrogenase, 3-hydroxyisobutyrate dehydrogenase [Bacillus ...
479432	Streptosporangium roseum DSM 43021	2 (0.05%)	2E-54	5-288	10-295	219	36	286	ref|YP_003340869.1|	NAD-dependent glycerol-3-phosphate dehydrogenase [Streptospo...
1967	Streptomyces kanamyceticus	1 (0.03%)	4E-53	3-286	20-304	214	36	285	pdb|3ZGY|A	Chain A, Apo-structure Of R-selective Imine Reductase From S...
481743	Paenibacillus sp. Y412MC10	1 (0.03%)	2E-49	4-289	26-310	202	32	287	ref|YP_003242108.1|	6-phosphogluconate dehydrogenase protein [Paenibacillus sp. ...
219305	Micromonospora sp. ATCC 39149	1 (0.03%)	7E-46	3-287	9-293	190	32	288	ref|WP_007075550.1|	dehydrogenase [Micromonospora sp. ATCC 39149] gb|EEP74285.1|...
404380	Geobacter bemidjiensis Bem	2 (0.05%)	6E-61	6-285	5-285	240	29	284	ref|YP_002137178.1|	glyoxalate/succinic semialdehyde reductase [Geobacter bemidj...
1315978	Pseudomonas aeruginosa VRFPA02	1 (0.03%)	1E-30	5-288	26-310	139	29	287	ref|YP_008132745.1|	oxidoreductase [Pseudomonas aeruginosa RP73] ref|YP_00880268...
208963	Pseudomonas aeruginosa UCBPP-PA14	1 (0.03%)	8E-30	5-288	13-297	137	29	287	ref|YP_791021.1|	dehydrogenase [Pseudomonas aeruginosa UCBPP-PA14] ref|WP_011...
443144	Geobacter sp. M21	2 (0.05%)	2E-58	6-285	5-285	232	28	284	ref|YP_003020170.1|	2-hydroxy-3-oxopropionate reductase [Geobacter sp. M21] ref|...
455488	Anaeromyxobacter dehalogenans 2CP-1	2 (0.05%)	1E-49	1-285	1-286	203	28	289	ref|YP_002491033.1|	6-phosphogluconate dehydrogenase [Anaeromyxobacter dehalogen...
447217	Anaeromyxobacter sp. K	2 (0.05%)	3E-49	1-285	1-286	201	28	289	ref|YP_002132986.1|	NAD-binding 6-phosphogluconate dehydrogenase [Anaeromyxobact...
347515	Leishmania major strain Friedlin	2 (0.05%)	7E-67	3-287	1-287	260	26	290	ref|XP_001684606.1|	putative 2-hydroxy-3-oxopropionate reductase [Leishmania maj...
573370	Desulfovibrio magneticus RS-1	1 (0.03%)	8E-66	3-287	2-287	256	26	289	ref|YP_002954877.1|	tartronate semialdehyde reductase [Desulfovibrio magneticus ...
691164	Geobacter metallireducens RCH3	1 (0.03%)	1E-64	3-287	2-287	253	26	289	ref|YP_006721965.1|	glyoxalate/3-oxopropanoate/4-oxobutanoate reductase [Geobact...
585503	Selenomonas noxia ATCC 43541	1 (0.03%)	1E-60	3-285	9-292	239	26	287	ref|WP_006693982.1|	oxidoreductase [Selenomonas noxia] gb|EFF65647.1| phosphoglu...