old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
	SNAMETSVIEASSLKLDDLHHIAISVTDVAQSVEWYTSHFQCRIAYQDSTWALLKFGNLSLALVIPEQHPPHIAFTSDRAGEYGSLKTHRDGTRSCYIQDPSGNSVELMDPTSL
tmhmm (0)	------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------
disordered (16%)	XXXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------XX
psipred	--------------------EEEEEE--HHHHHHHHHH----EEEEE---EEEEE---EEEEEE-------EEEEE---HHHHHHHHH-----EEEEEE-----EEEEEE----

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    31	    0.125
  max. Y    53	    0.138
  max. S    47	    0.281
  mean S     1-52   0.103
       D     1-52   0.122    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.122 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-114	alignment	4mymA_201	1-151	0.3443	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
521674	Planctomyces limnophilus DSM 3776	3 (0.08%)	2E-33	4-114	1-111	147	100	111	ref|YP_003629461.1|	glyoxalase/bleomycin resistance protein/dioxygenase [Plancto...
756272	Planctomyces brasiliensis DSM 5305	2 (0.05%)	2E-28	16-114	6-104	130	62	99	ref|YP_004270542.1|	glyoxalase/bleomycin resistance protein/dioxygenase [Plancto...
455065	uncultured planctomycete 13FN	1 (0.03%)	4E-20	4-113	11-121	103	57	111	gb|ABX10720.1|	hypothetical protein 13FN_9 [uncultured planctomycete 13FN]
748653	Thioalkalivibrio sp. ALJ17	2 (0.05%)	6E-27	4-113	1-107	125	55	110	ref|WP_018954596.1|	glyoxalase [Thioalkalivibrio sp. ALJ17]
396588	Thioalkalivibrio sulfidophilus HL-EbGr7	4 (0.1%)	8E-27	4-113	1-107	125	55	110	ref|YP_002513457.1|	glyoxalase/bleomycin resistance protein/dioxygenase [Thioalk...
95641	Methylomicrobium buryatense	1 (0.03%)	1E-24	16-110	1-95	118	52	95	ref|WP_017839980.1|	hypothetical protein [Methylomicrobium buryatense]
270495	Fangia hongkongensis	1 (0.03%)	4E-26	16-113	1-98	123	48	98	ref|WP_018299066.1|	hypothetical protein [Fangia hongkongensis]
203124	Trichodesmium erythraeum IMS101	3 (0.08%)	2E-31	14-111	1-114	140	40	115	ref|YP_722882.1|	glyoxalase/bleomycin resistance protein/dioxygenase [Trichod...
1303518	Chthonomonas calidirosea T49	1 (0.03%)	2E-18	14-110	1-105	98	37	105	ref|YP_008089328.1|	hypothetical protein CCALI_01393 [Chthonomonas calidirosea T...
91464	Synechococcus sp. PCC 7335	4 (0.1%)	2E-32	14-114	1-117	143	36	118	ref|WP_006456995.1|	glyoxalase [Synechococcus sp. PCC 7335] gb|EDX87210.1| glyox...
195252	Synechococcus sp. PCC 7502	1 (0.03%)	2E-31	14-112	1-115	140	36	116	ref|YP_007104620.1|	putative ring-cleavage extradiol dioxygenase [Synechococcus ...
316274	Herpetosiphon aurantiacus DSM 785	3 (0.08%)	2E-22	18-111	2-102	111	36	101	ref|YP_001543411.1|	glyoxalase/bleomycin resistance protein/dioxygenase [Herpeto...
179408	Oscillatoria nigro-viridis PCC 7112	1 (0.03%)	6E-33	14-111	1-114	145	35	115	ref|YP_007114861.1|	Glyoxalase/bleomycin resistance protein/dioxygenase [Oscilla...
756067	Microcoleus vaginatus FGP-2	2 (0.05%)	3E-32	14-111	1-114	143	35	115	ref|WP_006631220.1|	glyoxalase [Microcoleus vaginatus] gb|EGK90244.1| Glyoxalase...
272129	Oscillatoria sp. PCC 6506	3 (0.08%)	5E-32	14-111	1-114	142	35	115	ref|WP_007354995.1|	glyoxalase [Oscillatoria] emb|CBN55780.1| glyoxalase/bleomyc...
1173028	Oscillatoria sp. PCC 10802	1 (0.03%)	3E-34	14-111	1-114	150	34	115	ref|WP_017718547.1|	glyoxalase [Oscillatoria sp. PCC 10802]
56110	Oscillatoria acuminata PCC 6304	1 (0.03%)	3E-34	14-114	1-117	150	34	118	ref|YP_007084365.1|	lactoylglutathione lyase-like lyase [Oscillatoria acuminata ...
82654	Pseudanabaena sp. PCC 7367	1 (0.03%)	4E-30	14-113	1-116	136	34	117	ref|YP_007103829.1|	Glyoxalase/bleomycin resistance protein/dioxygenase [Pseudan...
321332	Synechococcus sp. JA-2-3B'a(2-13)	1 (0.03%)	8E-31	14-111	1-113	138	33	114	ref|YP_476540.1|	glyoxalase family protein [Synechococcus sp. JA-2-3B'a(2-13)...
634502	Arthrospira platensis str. Paraca	2 (0.05%)	9E-31	14-111	1-114	138	33	115	ref|YP_005067538.1|	hypothetical protein [Arthrospira platensis NIES-39] ref|WP_...