RC8

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
19638CompleteStructure prediction zhanghuaidongRC812125 Mar 202028 Apr 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120 
   sequence: QVQLVQSGGGLVQPGGSLRLSCAASGGSLSTTSSGMSWVRQAPGKGLEWVAAIYPDGVTKFHADSVKGRFTISRDNSKNTLYLQMNTLRAEDTAVYYCVRGPNYDSSKDYWGQGTLVTVSS
 deepconcnf: -EEEEEE--EEE-----EEEEEEEE--EEE----EEEEEEE-----EEEEEEE------EEE-------EEEEEE----EEEEEE--------EEEEEEE-------------EEEEEEE-
    psipred: --EEEEE---EE-----EEEEEEEE--EE----EEEEEEEE------EEEEEEE-----EEE-HHH---EEEEEE----EEEEEE----HHH-EEEEEEE--------------EEEEE--
    spider3: -EEEEE-----------EEEEEEEE-EEE------EEEEEE------EEEEEEE-------E-HHH---EEEEE-----EEEEEE----HHHHEEEEEE---------------EEEEE--
   disopred: ------------------------------------------------------------------------------------------------------------------------D
      tmhmm: -------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
19372110.94comparative modeling1-12112126 Mar 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington