2019-06-29_00000122_3_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
5764CompleteStructure predictionrobetta_beta2019-06-29_00000122_3_194829 Jun 2019-
             1   .   10    .   20    .   30    .   40    .   
   sequence: GHMKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPAS
    psipred: --------EE---------HHHHHHH--------------EEEE----
    spider3: ---------------------EEEEE---------------EEE----
 deepconcnf: -------EEEEE-----------EEE--------------EEEE----
   disopred: DDDDDD-DDD-------DDDDDDD----------------------DD
      tmhmm: ------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
5933110.11comparative modeling1-484829 Jun 2019
5934120.29ab initio1-484829 Jun 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington