2019-06-29_00000167_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
5774CompleteStructure predictioncameo2019-06-29_00000167_1_1129529 Jun 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
   sequence: MIVAEIQKNSLKEQRIKFIRNHQQAFDVEPIYPLRLFEDFVMSVEGDCSIEASCKIELDKLIASRFMLFFKDQEWEKYLTQSLAFFRQVENRVGVQLDYSLLQKFLGHNFDFSKLEVLSAGLDLRTNLADSSLKIHIRIKDYPEKINQALSLTIDGDDLTAVRDFLSVVGFDFYFDGRSAIEIYPEVKKEDFFKPKTQEKVWQHLPKFVLEPLQVTNLFGFGFSKTNHNPVVYYRLKGRQDLTNYFKINDTAQRVHSFYQHQDILPNMWVGTTQKELEKTRIENIRLYYYKSFKM
 deepconcnf: ----HH-----HHHHHHHHHHHHHH--------HHHHHHHHH------EEEEEEEEE--EEEE-----------HHHHHHHHHHHHHHHHH----EE-HHHHHHHH--------EEEEEEEEE--------EEEEEEEE---HHHHHHHHH--------HHH---EEEEEEEEEE---EEEEEEEE--------HHHHHHHHHH--HHHHHHH----EEEEEEE------EEEEE------HHHH----HHHHHHHHHHH------EEEEEEEHHHHHH----------------
    spider3: -HHHH-----HHHHHHHHHHHHHHH-------HHHHHHHHHHH-----EEEEEEEEE--EEEEEEEE-------HHHHHHHHHHHHHHHHH-------HHHHHHHHH----HHHHHHHHHHHHH-------EEEEEEEE---HHHHHHHHHH------HHHHH---EEEEEEEE-----EEEEEEE--HHHH--HHHHHHHHHH--HHHHHHHHH--EEEEEE-------EEEEE---H-HHHHH--HHHHHHHHHHHHH-------EEEEEEHHHHHH--HHHEEEEEH-----
    psipred: --HHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHH------EEEEEEEE---EEEHHHEE------HHHHHHHHHHHHHHHH-----EEE-HHHHHHHHH----HHHHEEEEEEEE----HHHHEEEEEEEE---HHHHHHHHHH------HHHH----EEEEEEEEE----EEEE-----HHHH--HHHHHHHHHH--HHHHHHHHHH-EEEEEE-------EEEE----HHHHHHH----HHHHHHHHHHH-------EEEEEEHHHHHH--HHEEEEEEEE----
   disopred: DDDDDDDDDDDDDD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
5941110.99comparative modeling1-29529529 Jun 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington