Y13E Domain 1 Parse 1 Confidence: 0.32

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
139310ExpiredStructure prediction xliu683Y13E8314 Oct 202128 Nov 2021
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
135604110.32comparative modeling1-818114 Oct 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80 
   sequence: GYIPEAPRDGQAEVRKDGEWVLLSTFLGYIPEAPRDGQAEVRKDGEWVLLSTFLGYIPEAPRDGQAEVRKDGEWVLLSTFL
     chains: AAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCC
 deepconcnf: ------------EEEE---EEE----------------EEEEE--EEEEE----------------EEEE--EEEE-----
    psipred: ---------HHHHE------------------------EEEEE----EE----------------EEEE---EEEE-----
    spider3: ---------HHHHE-----EEE----------------EEEEE--EEEE-----------------EEE----EEE-----
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington