vgll1 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
139364ExpiredStructure prediction JAEHUIvgll18814 Oct 202128 Nov 2021
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
135636110.59RoseTTAFold1-888814 Oct 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   
   sequence: MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTK
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington