vaccine predict domains Domain 2 Parse 1 Confidence: 0.04

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16257Domain completeStructure predictionabhinandvaccine predict domains42417 Feb 202025 Oct 2020
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16153210.04comparative modeling136-30817318 Feb 2020
               140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .   
   sequence: LGRAGKDGKSGKNGGPGPGDEEFDDGSNDETDDGPGPGLLIAFGLVIGPGPGAKGEFVKTDGKKKQGPGPGIGLIAGALAQREAQIPQGPGPGGVEGEPEIECGPTSGPGPGYQCQISITIGPGPGVVVQKPIYLGPGPGLRKEERQKQIERKSGPGPGVRWLDGNQTGPGPG
 deepconcnf: --------------------------------------EEEEEEEEE--------EEEEE--EEEE----HHHHHHHHHHHHH-----------------EE-----------EEEEEEEE-----EEEE--EE--------HHHHHHHHHHH-------E------------
    psipred: -------------------------------------EEEEEEEEEE--------EEEE------------HHHHHHHHHHHH-----------------------------EEEEEEEEE-----EEEE--EEE-------HHHHHHHHH---------EE-----------
    spider3: ---------------------------------------EEEEEEEE--------EEEE-------------EEEE-EEEEEEEE---------------------------EEEEEEEEE------EEE------------HHHHHHHH-----------------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington