2020-08-01_00000121_1_11 Domain 1 Parse 1 Confidence: 0.83

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
33882CompleteStructure predictioncameo2020-08-01_00000121_1_11601 Aug 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
33072110.83comparative modeling1-60601 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60
   sequence: SDQEAKIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQ
    psipred: ------EE--EE--------EEE--EE---------HHHHH----------EEEE-----
 deepconcnf: -----------------------EEEE--------HHHHH------------EEE-----
    spider3: ----------EE---------E-EE-----------HHHHHH---------EEE------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington