A0A009E901_lab13 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
450770ExpiredStructure prediction zavageA0A009E901_lab138024 Nov 202212 Jan 2023
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
446086110.81RoseTTAFold1-808024 Nov 2022
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
   sequence: MFPAIAILLVACLFPALNYYALEASEKSFNQTTNFLSQPVHKFSANKITVLWGMWYMKALYLAIAGLIGFGIAKAWQSKT
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington