RGTSKVF LDHWQTG ANYCEAK TWFREMC Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
640584CompleteStructure prediction Michael-RGTSKVF LDHWQTG ANYCEAK T...4207 Nov 202422 Dec 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
634180110.59RoseTTAFold1-4204207 Nov 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
   sequence: RGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMCRGTSKVFLDHWQTGANYCEAKTWFREMC
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington