defensin-modified-20251206 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 695925 | Complete | Structure prediction | universexplorer | defensin-modified-2025120... | 68 | 6 Dec 2025 | 20 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 686658 | 1 | 1 | 0.75 | RoseTTAFold | 1-68 | 68 | 6 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MRTSYLLLFFLCLLLSEMAIGGNFLTGLGARSDHYNCVSVGGQCLYSACDIFTKIQGTCYRGKAKCCK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington