User input for job 154555

Modeling method RoseTTAFold only

Sequence

MANLNQIQKEVSEILSDQKSMKADIKAILELLGSQNPIKESLETVAAKIVNDLTKLINDCPCNKEILEALGTQPKEQLIEQPKEKGKGLNLGKYSYPNYGVGNEELGSSGNPKALTWPFKAPAGWPNQF
/
MANLNQIQKEVSEILSDQKSMKADIKAILELLGSQNPIKESLETVAAKIVNDLTKLINDCPCNKEILEALGTQPKEQLIEQPKEKGKGLNLGKYSYPNYGVGNEELGSSGNPKALTWPFKAPAGWPNQF
/
MANLNQIQKEVSEILSDQKSMKADIKAILELLGSQNPIKESLETVAAKIVNDLTKLINDCPCNKEILEALGTQPKEQLIEQPKEKGKGLNLGKYSYPNYGVGNEELGSSGNPKALTWPFKAPAGWPNQF
/
MANLNQIQKEVSEILSDQKSMKADIKAILELLGSQNPIKESLETVAAKIVNDLTKLINDCPCNKEILEALGTQPKEQLIEQPKEKGKGLNLGKYSYPNYGVGNEELGSSGNPKALTWPFKAPAGWPNQF

MSA



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington