User input for job 154566

Modeling method RoseTTAFold only

Sequence

MTNTVKHSMARLRAKMLGAAKMFPDYNFRHYFVQHVKDQFVAMEKWGVEEQRRFLRQEGAKKLSEMRRMALVNRMYSSQPVFLDERAASKPSVTQEEEE



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington