User input for job 345579

Modeling method RoseTTAFold only

Sequence

MYNGGPSTPTQQSGPLRPYLSSPHTPYISPHHHQLYRSPAMDSFGPPSPSSPYLDSSPASTSYIHHANTSNSSLAPTTRSYMSPHFSQQFDSLSTSSPAHLPAQLPSPVEQQHVVVLDWSPLEGGQGTTLSIKCEVNLPPTPSPSYDGSDESNPGSHGKALRVVFGSQPVQTTVHILSSASHLGGGQICQLTATAPSWATTGGIPTSRGNRVSVYIQVLADNHNVIETVLMGEFAYIAGPSRIPFNSYPSNGSLKRAGESLESHRPSPNQFLHRRVFSNSTVSRMDSPVIEQFSQLGATYHPPPPEHGYSSPYTGASATLPTMPAPPGPAYSPSPGAQPSLMRSTQVSVAAPAPTTYTPSSGGKASLELSNDLASMSKGW



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington