User input for job 378453

Modeling method RoseTTAFold only

Sequence

MSPRPSSVMTPPRQSSVMPPRAPGPAMTAAMEHFERIHLQEAANLLKELDKPSYGQMDLARKSVDLGRKSVDLGRKSVDHRDTATTDHHQDHHKNGEHHHRHSDQHRRIDRHCHSDHHKSHQKSHGSSHHHRSPHRRRHHRDDDKNSISSNYTDADDNVSNASSVHRERHHRSHHSRSSHHKEHGSHSHHHSSHKDHHHSRDRYHHRSYHSPDRHSQHSQERSSGHKHHARSPERHGHSSHSHHSQGHRHRSSSHKSHHSRSPDRHHSHGHRHHHHKECSDGHHSSHHSKESRGHHHHYESSEHRGHHRSRDHSEGSEHRGHHRSPDHKESSEHRGHHRNRDHKEGSEHSHPASSSHHRSSPHKKESSKSRHDQHKDRQCEDTESIISRRSDASIHTHHRRHALPVN



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington