User input for job 37931

Modeling method CM only

Sequence

/
MLALSRTRALARPLRNNFARNYVVASQTARATEAPNFGQKKGYPIIDHEFDAVVVGAGGAGLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQDGECVGVLAINMEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLVNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIFLQLSHLPAEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTIDEQGNDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANHIKETLAPNTPHKPMNPELGKESIEDLDKIRNASGPLPTSQIRLNMQKTMQTDAAVFRTQQSLDEGVAKMREVYKSYDQVGIKDRSMIWNSDLIETLELRNIMQNAMQTVVSAAARKESRGAHAREDYPERNDEEWMKHTLSFQHDPNSPDVELKYRGVIANTLDEAECKPVPPFKRTY
/
MSTSILRNSLARAVHKPSILRTTPGLMLAQRRLASTESVTAAESIALLNSQRQHRPTSPHLAIYQPQLTWYLSSLHRITGVAFGGALYLSAMAYLLHPLVPVIDSAHLIQLVHDLPGWFKGSAKFIIALPFTFHCYNGLRHLNWDIGKALTIKGVYRTGYAVLGATVLSSLYLAFFI
/
MSFIRPSATPAFRAVGLGLGRRCLHNSRPLALGASQVKRDALVASNETGGFKYIPGGPILPGTVNDATTFPTPNKSHGSYHWAFERLLSASLIPITVGAAVSSGSAYPIMDGILAISLIVHTHIGFDACVVDYVHPRKFPVLGPITKWILRAATGLSVWGVYEFNTNDIGLTELVKRAWTA
/
MVRPATVLRSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQPPIKEFKIYRWNPDVPNEKPKLQTYKIDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPKDTSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKAIEPYLKNDNPPEKGEFLQSQADRKKLDGMYECILCACCSASCPSYWWNQDEYLGPAVLMQAYRWMADSRDSYGAERKEKMQNAMSLYRCHTIFNCSRTCPKGLNPAAAIAKMKLEMATGE



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington