User input for job 37968

Modeling method CM only

Partial threads

Sequence

AYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFNNCTFEYVSFKNLREFVFKNYFKIYSKHTPINDLPQGFSALEPLVDLPIGINITRFQTLLAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRKPFERPLQSYGFQPTNGVGYQPYRVVVLSFATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNEVAVLYQGVNCTEVNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTSQSIIAYTMSLG



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington