User input for job 41324

Modeling method TrRosetta only

Sequence

STIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNDTNVDTNVDTNVTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTK



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington