User input for job 419027

Modeling method RoseTTAFold only

Sequence

MAQGVVTLGVRATSVNGTGSIKAVDGQFVFVPYDNTPPTVTVDIVNASLNDGTNSSLVNFEFSETVNGFTAGDVNVSGGTLSDFTQVDGNSYTAIFTATDAVETIGSVSVAADSYSDIAGNNGGAGSDTVTIDTLNPTLALDIVNASLNDGTNSSLVNFEFSETVNGFTAGDVSVSGGTLSDFTQVDGNSYTAIFTADDAVETTGSVSVAAASYSDVAGNQGGAGTDTVTIDTKNPTLAVDIVDASLNDGDNNSLVSFEFSEDVAGFDNSDVSVSGGTLSDFTQVDGNSYTAIFTADDAVETTGSVSVAAASYSDVAGNDGGAGTDTVTIDKLNGA



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington