User input for job 435544

Modeling method RoseTTAFold only

Sequence

MCVSPRNTASAWASSSRKAVKVRSSPVRPLRTVVARSRSGADQGERLDPAPGRPGCENEVGVRQARLHRGIHRIHAYRRVTSSTSGYPLLSLEHETGKLRWDPVEPENEAAPMKEGDTLTRGERSGSQARHGDALSLGHCYGDRIHLLNEPYLLSLISRIGSPDSDGEPLPQLVRTGYKRLFQAILNEHFPTTTECVPTRMAPADPRGVYVGPRFRHDVRLVICSIVRGGVVPGQVCYEAACEVLPSRNVRLDFFCASRTVDAHGVVTGVQLDGTKIGGSIKDSILVIPDPMCATGSTVATVLEAYEEFDGAEALAVVSANLIVTPEGVQAIKERFPKAHLWAARLDRGASPEHVLNTIPGTYLAEESGLNENQYILPGAGGLGEALTNVDV



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington