User input for job 454417

Modeling method RoseTTAFold only

Sequence

TSHAIAADLSEMELKKILIEQMEGNKSIQRSDEQRNLYKALIEAYEADKSILDTYGDSTILKRRREDDDQEGPSAGPNRGSKRQKEGGEQASASTPSEKATKGAGGSTTGSQSRQRSTSESAYAEEPVQTTCQIEETPHPPRRPPSPDRAWNTALPAAQGDAQSWISDLAWQTDARSSFNELLDTPIDFSNFIMHRLNVDTLTPDLLAGPTYELMRGSCSSLTELEYHLEEVYKATTDQLDWVNPKGQQYPHNLLQPLPLIPDNRGRQVIPFEHLINNDLEYLRGGASSHKYTTSVTKTKAADYGHIKWIEDLVPREM



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington