User input for job 454429

Modeling method RoseTTAFold only

Sequence

MSYQTGLESVEATLLVYKQNESILEGKIKLLNIEVQLRDTALATLRQKLETTKKERGDLNMKLEKFQTSSKRLTDLLASQTSEKAGLGYNSKVFTQAMFDCENYYSSESDNDSWPPSNLYDRFVPSGGYHVVPPLVSGTFMPPKPDFVFHTPPSNENEHLAFNVQLSPTKPEQDLSSRPSAPIIEDWVSDFEDDMPRVTKDVPSFAQSPELVNSPRHSGMLSPPPMSVAPYVPLRTQTRPNIASHVVSKSKSPLRRSFTRHSSSKPINSPLRVTAAKPSTGNPQQALKDKGVIDSGCSRYMTGNMSYLSDFEELNEGYVAFEGNPKGGKITGK



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington