User input for job 45754

Sequence

PPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington