User input for job 67451

Modeling method CM only

Partial threads

Sequence

MKTSVVFLVVLTAGLLLLSEAAAEYRCELIRNLGKGKGSFTNYYYDKATNSCKTFRYRGTSGNGNRFKTLEECETTCVTGPDEVL



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington