User input for job 67496

Modeling method TrRefineRosetta only

Sequence

MKVSAATAVLVALVATVQSSDPCNISTCYKSGTTKPPMNVTPTRLPVQSSSTPTSHPQTTYAKDHAHGSTTVKSGANATATTASGASVNGTERPAVAKSSAGVTGNSTTPKPTMTEGHVALKQKLNTIAVKCKDELHAPQEIMALVSNTVVPQNEQQRCYLECVYKNLNLIKNNKFSVDDGKAMARIRFANQPEEHKKAVTIIETCEKEAVIDPKTTEKCAAGRVIRNCFVKNGEKINFFPKA



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington