M8B

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
101109CompleteStructure prediction peixiaoqiongM8B24922 Jul 20212 Oct 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .    
   sequence: MGILDNKVALVTGAGSGIGLAVAHSYAKEGAKVIVSDINEDHGNKAVEDIKAQGGEASFVKADTSNPEEVEALVKRTVEIYGRLDIACNNAGIGGEQALTGDYSLDSWRKVISINLDGVFYGCKYEIPQMLKNGGGVIVNMASIHGIVAAPLSSAYTSAKHGVVGLTKNIGAEYGQKNIRCNAVGPAYIETPLLESLTKEMKEALISKHPIGRLGKPEEVAELVLFLSSEKSSFMTGGYYLVDGGYTAV
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
95849110.92RoseTTAFold1-24924929 Jul 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington