N-SC

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
101144CompleteStructure prediction 15282877967N-SC12122 Jul 20212 Oct 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120 
   sequence: HHHHHHAMVDTLSGLSSEQGQSGDMTIEEDSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHI
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
95926110.75RoseTTAFold1-12112129 Jul 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington