FAST2_awoopt

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
126908CompleteStructure prediction AlexMFAST2_awoopt12515 Sep 202130 Oct 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
   sequence: MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFKEGVASGNLNTMFEWMIPTSRGPTKVKIHMKKALSGDSYWVFVKRV
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
123222110.90RoseTTAFold1-12512515 Sep 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington