Ma5 AB

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
139245CompleteStructure prediction ericmartzMa5 AB9113 Oct 202128 Nov 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90 
   sequence: MQFTKIASVLAMAAAATAAPAPGNYEVEPRTGGGNKNQPACSAQSQQVCCTGLSCLVQVLGGCSTSSFCCETDAPNGALVNVALLNCVNLL
 deepconcnf: -HHHHHHHHHHHHHHHHH----------------------------EEE-------------------E----------EEE-----EE--
    psipred: -EEHHHHHHHHHHHHHHH----------------------------EEE-----------------EEE---------EEEE-----HH--
    spider3: ---HHHHHHHHHHHHHHH----------------------------EEEE----EE----------EEEE--------EEEE----HHHH-
   disopred: --------------------DDDDDDDDDDDDDDDDDDDDDDDDD----------------------------------------------
      tmhmm: -------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
135533110.23ab initio1-919113 Oct 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington