2020-01-18_00000149_2_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14236CompleteStructure predictioncameo2020-01-18_00000149_2_1126518 Jan 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
   sequence: MDNLTKVREYLKSYSRLDQAVGEIDEIEAQRAEKSNYELFQEDGVEEHTKPSYFQAADDSDTESEPEIEDNQGLYAQDPEAEQVEGFIQGPLDDYADEEVDVVFTSDWKPPELESDEHGKTLRLTSPEGLSGEQKSQWLSTIKAVVQSAKYWNLAECTFEASGEGVIMKERQITPDVYKVTPVMNTHPSQSEAVSDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSL
    psipred: -HHHHHHHHHHH----HHHHHHHHHHHHH-----------------------EE---------------------------------------------EEEEE---------EE-----EEEEE------HHHHHHHHHHHHHHHHHH------EEEEEEE--EEEEEEEE------------------------HHH----EEEEE--------EEEEHHHH---HHHHHHH-------HHHHHHHHHHH---EEEEEEEEE-
   disopred: DDDDD--D------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD---------------DDDDDDDDDDDD-------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDD----------DDDDDD--------------------------------------------------
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14189110.60comparative modeling1-606019 Jan 2020
14190210.14comparative modeling57-26520919 Jan 2020
14191220.21ab initio57-26520919 Jan 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington