2020-01-18_00000158_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14240CompleteStructure predictioncameo2020-01-18_00000158_1_115718 Jan 2020-
             1   .   10    .   20    .   30    .   40    .   50    .  
   sequence: MDGLELRKLGEVSWEEEAEISGSSARYDVTLSEQGEFKLLSEEKVPWDGGGGSGGGG
 deepconcnf: ----EEEEEEEEEE----------EEEEEEE-----EEEEE----------------
    psipred: ---EEEEEEE--EE-----------EEEEEE-----EEEE------HHHEE------
    spider3: ----EEEEEEEEEE-HHHEE-----EEEEEE-----EEEE-----------------
   disopred: D------------------DD---------------------------------DDD
      tmhmm: ---------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14193110.77comparative modeling1-575719 Jan 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington