2020-01-18_00000166_2_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14242CompleteStructure predictioncameo2020-01-18_00000166_2_119318 Jan 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90   
   sequence: SNAMSEAKKLNIGRELTDEELMEMTGGSTFSIQCQKDYTYKPSLPVVKYGVVIDEPEVVIKYGVGPIVGIKYGVEPIGPIQPMYGIKPVETLK
 deepconcnf: -----------------HHHHHHHH-------E----EEE------EEEEEEE--HHHHHHH-----EEEE----------------------
    psipred: --HHHHHH---------HHHHHHHH---EEEEE-----EE------EEEEEEE----EEEE-------EEEE--------------EE-----
    spider3: -----------------HHHHHHHH--------------------------E------EE---------------------------------
   disopred: DDDDDDDDDDDDDDD---------------------------------------------------------------------------DDD
      tmhmm: ---------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14214110.15comparative modeling1-939319 Jan 2020
14215120.21ab initio1-939319 Jan 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington