toxo

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14274Domain completeStructure prediction JorgePtoxo19019 Jan 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
   sequence: MVRVSAIVGAAASVFVCLSAGAYAAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE
   disopred: DD-------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD---------------------------------------------------------------------------------DDDDDDDDDDDDDDDD----------------DDDDDDDDDDDDDDDDDD---DDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.01comparative modeling1-190190-
14819120.33ab initio1-19019029 Jan 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington