AtSTOP1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14293Domain completeStructure prediction bs19ocaAtSTOP128919 Jan 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .    
   sequence: MKDEDDVEEGENLPPGSYEILQLEKEEILAPHTHFCTICGKGFKRDANLRMHMRGHGDEYKTAAALAKPNKESVPGSEPMLIKRYSCPFLGCKRNKEHKKFQPLKTILCVKNHYKRTHCDKSFTCSRCHTKKFSVIADLKTHEKHCGKNKWLCSCGTTFSRKDKLFGHIALFQGHTPAIPLEETKPSASTSTQRGSSEGGNNNQGMVGFNLGSASNANQETTQPGMTDGRICFEESFSPMNFDTCNFGGFHEFPRLMFDDSESSFQMLIANACGFSPRNVGESVSDTSL
 deepconcnf: -----------------EEEEEE----EE----------------HHHHHHHH---------HHHH-----------------EEE-------------------EEEEE------------EE----------HHHHHHHHHHHH----EEEE---EE------EEEEE-----------------------------------------------------------------------------------------------EEE---------------------
    psipred: -----------------EEEEEE-HHHH----------------------------------HHHH---------------EEEE---------------------EEEE----------------------EEEEEE----HH------EEE--------------EEE-----------------------------------------------------------------------------------------------------------------------
    spider3: -----------------HEEEEEHHHHH---------------E--HHHHHHH---------HHHH---------------EEEE----------HHHH------HEEEE--------------------EEEEEEEE------------EE--------HHHHHHHHHHH----------------------------------------------------------------------------------------------------------------------
   disopred: DDDDDDDDDDD-------------------------------------------------------DDDDDDDDDDDDDDDD----------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD--------------------------------------------DDDDDDDDDDDDDDDDDD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14421110.08comparative modeling1-28928922 Jan 2020
-12n/aab initio1-289289-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington