seq2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14339Domain completeStructure prediction mrinal18398seq24820 Jan 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   
   sequence: MAEMTSNGLMRLPHFTSSKTSVEKYEPIYQNLFTLTLSPPPALGKADD
 deepconcnf: ---------------------HH-HHHHHH-----E------------
    psipred: ---------EE---------HHHHH-HHHHHEEEEE------------
    spider3: ------------------------------------------------
   disopred: DDDDDDDDD-------------------------------DDDDDDDD
      tmhmm: ------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14370110.14comparative modeling1-484821 Jan 2020
-12n/aab initio1-4848-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington