M119A

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14359Domain completeStructure predictionasitM119A12620 Jan 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    . 
   sequence: MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPHPRAATRPPPLPAHTPAHTPEWCGAASAEAAEPRRAGPHLCIPAPGLTKTPILEKVPRKAAAKTPSS
 deepconcnf: --HHHHHH--------------------------EEE------------------------------------------------------------EEEE----------------HHH------
    psipred: -----HHH--------EEE----------------EEE------------------------------------------------------------EE---------HHHHH--HHHH------
    spider3: ----------------------------------EEE-------------------------------------------------------------EEE-------------------------
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-----DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-----------DDDDDDDDDDDDDDD------------------DDDDDDDDDDD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14495110.01comparative modeling1-12612623 Jan 2020
-12n/aab initio1-126126-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington