HBx_2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14499Domain completeStructure prediction ehartHBx_215422 Jan 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    
   sequence: MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPVCSFSSAGPCALRYTSARRMETTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKWVCSPAPCNFFTSA
   disopred: D--------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDD-------------------------------------------------------------------------------------------------------D
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.02comparative modeling1-154154-
14569120.21ab initio1-15415424 Jan 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington