Tb427.10.11300

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
154563CompleteStructure prediction Youngjordan7001Tb427.10.1130012625 Nov 20219 Jan 2022
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    . 
   sequence: MSHYLLVTFTFNCPEIRILGPIKEQTIEKLNDVIPNATTTSRSNRTALPKFEYLPNPNHWYIKLDRQFCDEDGKSHLMVLLLDALSEEGSWRLVSSFVTKEPSGTGSKEGTETHTLFLNKLLAEDS
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
150716110.83RoseTTAFold1-12612625 Nov 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington