TND AC2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16134Domain completeStructure predictionnidaa_ali01TND AC213914 Feb 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .    
   sequence: MQSLSHSKNHSIPVAKTSLPQKKKKSIRRRRVDLQCGCTYYCSIHCHDHGFTHRGVHHCGSSREWRIYLGNSKSPVFQNFETQQQTLPKTARHHQYSNTIQPQPAESPGTSQVFSNFQNLDGLTPSDWDFLESLQNTGP
 deepconcnf: --------------------HHHH-----EEEE-----EEEEE---------------------EEEEE----------------------------------------------------------HHHHHHHH----
    psipred: ----------------HHHHHHH------EEE------EEEEE----------------------EEE--------------------------------------------------------HHHHHHHHH------
    spider3: ------------------------------EEE-----EEEEEE------------EEE-----EEEE--------------------------------------------------------HHHHHHHHHH-----
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD----------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD----------------------DD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16301110.06comparative modeling1-13913920 Feb 2020
-12n/aab initio1-139139-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington