Prot

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16146Domain completeStructure prediction EdoProt7514 Feb 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
   sequence: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
 deepconcnf: -----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------
    psipred: ---HHH--EEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HH-EEE--EEEEEHHHHHHHHH--HHH--
    spider3: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHH-HHHHEH----------------
   disopred: D--------------------------------------------------------------------------
      tmhmm: -----------TTTTTTTTTTTTTTTTTTTTTTT-----------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
17853110.11comparative modeling1-757510 Mar 2020
-12n/aab initio1-7575-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington