2020-02-15_00000023_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16165CompleteStructure predictioncameo2020-02-15_00000023_1_117915 Feb 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .    
   sequence: MAMVINVSFKVTGGKEFTVAIEPDITVLDLKKICAEHVDIPVEAQRIIFKGKILKDKESLTLYGVADGNTMHLVRSAMA
 deepconcnf: ----EEEEEE-----EEEEEE-----HHHHHHHHHHH-------EEEEE--EE----------------EEEEEE----
    psipred: -----EEEEEE----EEEEEE----HHHHHHHHHHHH----HHHEEEEE----------HHH-------EEEEEE----
    spider3: ----EEEEEE-----EEEEEE-----HHHHHHHHHHHH---HHHHEEEE---E------HHHH------EEEEEE----
   disopred: DD---------------------------------------------------------------------------DD
      tmhmm: -------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16001110.95comparative modeling1-797915 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington