2020-02-15_00000245_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16181CompleteStructure predictioncameo2020-02-15_00000245_1_119715 Feb 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  
   sequence: ALCCLWSDWINEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCA
 deepconcnf: ---------H--------------------------EEEEEE------------EEEEE-----EEE---------------EEEEEEE--------
    psipred: ----------------------------HH------EEEEE-------HHH---EEEE------EEE----------------EEEEE---------
    spider3: -----------------------------------EEEEEE-------HHHH--EEEE-----EEEE---------------EEEEEE---------
   disopred: D-----------------------------------------------------------------------------------------------D
      tmhmm: -------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16028110.20comparative modeling1-979715 Feb 2020
16029120.25ab initio1-979715 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington