2020-02-15_00000314_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16189CompleteStructure predictioncameo2020-02-15_00000314_1_119615 Feb 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    . 
   sequence: AYSITLRSPDGAEEVVQCEEDQYILEAAEDAGLDMPSSCRAGACSACLGKVLEGSVNNEEQSFLDDDQLEEGWSLLCVAMPQSDCVILTEQEDNLD
 deepconcnf: -EEEEEE-----EEEEEE-----HHHHHHH-----------------EEEEEE-EEE--------HHHHHH-EEEEE-------EEEE--------
    psipred: -EEEEEE-----EEEEE-----HHHHHHHH-----------------EEEEEEEEEE--------HHHHH---EEEE--EE---EEEEE-------
    spider3: EEEEEEE-----EEEEE-----EHHHHHHH-------H---------EEEEEEEEEE--------HHHHH---EEEEEE-----EEEEE-------
   disopred: ------------------------------------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16027111.00comparative modeling1-969615 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington