ggCCm

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16329Domain completeStructure prediction MA4ggCCm7618 Feb 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    . 
   sequence: NESSDNSEDLHCQIKNLLSDEIGRQKIVLPSNTPNVRRTKRIRLKPLEYWRGERVTYTLKPSGRLLISGIAGAEAE
 deepconcnf: ----------EEEEEEE-------EEEE-------EE----------------EEEEEE-----EEEEEEE-----
    psipred: ---------HHHHHHH------EEEEEE------------EE----HHHH---EE---------EEEEEEE-----
    spider3: ------------EEE--------EEEEE-------------EEE--HHE----EEEEEE-----EEEEEEE-----
   disopred: DDDDDDDDDDDDDDDDDDD-------------------------------------------------D---DDDD
      tmhmm: ----------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16165110.02comparative modeling1-767618 Feb 2020
-12n/aab initio1-7676-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington