ggCCm

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16330Domain completeStructure prediction MA4ggCCm7618 Feb 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    . 
   sequence: NESSDNSEDLHCQIKNLLSDEIGRQKIVLPSNTPNVRRTKRIRLKPLEYWRGERVTYTLKPSGRLLISGIAGAEAE
   disopred: DDDDDDDDDDDDDDDDDDD-------------------------------------------------D---DDDD
      tmhmm: ----------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.02comparative modeling1-7676-
16166120.35ab initio1-767618 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington