desmin_DES-J_DES-Y

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16508Domain completeStructure predictionsheila.lucia.cdesmin_DES-J_DES-Y47120 Feb 202028 Aug 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470 
   sequence: MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD----------------------------------------------------------DDDDDD-D----------------------------------------------------------------------------------------------------DDDDDDD---------------------------------------------DD-DDDDDDDDDD-----------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD---------------DDDDDDD-D
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16970110.37comparative modeling1-888828 Feb 2020
17148210.62comparative modeling84-150672 Mar 2020
-310.73comparative modeling147-289143-
-410.28comparative modeling286-471186-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington